Anti DHX57 pAb (ATL-HPA036160)

Atlas Antibodies

SKU:
ATL-HPA036160-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57
Gene Name: DHX57
Alternative Gene Name: DDX57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035051: 90%, ENSRNOG00000054272: 90%
Entrez Gene ID: 90957
Uniprot ID: Q6P158
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVR
Gene Sequence KRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVR
Gene ID - Mouse ENSMUSG00000035051
Gene ID - Rat ENSRNOG00000054272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX57 pAb (ATL-HPA036160)
Datasheet Anti DHX57 pAb (ATL-HPA036160) Datasheet (External Link)
Vendor Page Anti DHX57 pAb (ATL-HPA036160) at Atlas Antibodies

Documents & Links for Anti DHX57 pAb (ATL-HPA036160)
Datasheet Anti DHX57 pAb (ATL-HPA036160) Datasheet (External Link)
Vendor Page Anti DHX57 pAb (ATL-HPA036160)