Anti DHX40 pAb (ATL-HPA044350)

Atlas Antibodies

SKU:
ATL-HPA044350-100
  • Immunohistochemical staining of human testis shows strong nuclear positivity in Leydig cells, as well as moderate positivity in cells in seminiferous tubules.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 40
Gene Name: DHX40
Alternative Gene Name: ARG147, DDX40, FLJ22060, PAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018425: 97%, ENSRNOG00000004549: 96%
Entrez Gene ID: 79665
Uniprot ID: Q8IX18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Gene Sequence SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
Gene ID - Mouse ENSMUSG00000018425
Gene ID - Rat ENSRNOG00000004549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX40 pAb (ATL-HPA044350)
Datasheet Anti DHX40 pAb (ATL-HPA044350) Datasheet (External Link)
Vendor Page Anti DHX40 pAb (ATL-HPA044350) at Atlas Antibodies

Documents & Links for Anti DHX40 pAb (ATL-HPA044350)
Datasheet Anti DHX40 pAb (ATL-HPA044350) Datasheet (External Link)
Vendor Page Anti DHX40 pAb (ATL-HPA044350)