Anti DHX38 pAb (ATL-HPA041604)

Atlas Antibodies

SKU:
ATL-HPA041604-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 38
Gene Name: DHX38
Alternative Gene Name: DDX38, hPrp16, KIAA0224, PRP16, PRPF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037993: 97%, ENSRNOG00000014619: 97%
Entrez Gene ID: 9785
Uniprot ID: Q92620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSIL
Gene Sequence IPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSIL
Gene ID - Mouse ENSMUSG00000037993
Gene ID - Rat ENSRNOG00000014619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX38 pAb (ATL-HPA041604)
Datasheet Anti DHX38 pAb (ATL-HPA041604) Datasheet (External Link)
Vendor Page Anti DHX38 pAb (ATL-HPA041604) at Atlas Antibodies

Documents & Links for Anti DHX38 pAb (ATL-HPA041604)
Datasheet Anti DHX38 pAb (ATL-HPA041604) Datasheet (External Link)
Vendor Page Anti DHX38 pAb (ATL-HPA041604)