Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047607-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DHX37
Alternative Gene Name: DDX37, KIAA1517, MGC2695, MGC4322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029480: 87%, ENSRNOG00000022171: 87%
Entrez Gene ID: 57647
Uniprot ID: Q8IY37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLD |
| Gene Sequence | VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLD |
| Gene ID - Mouse | ENSMUSG00000029480 |
| Gene ID - Rat | ENSRNOG00000022171 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) | |
| Datasheet | Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) | |
| Datasheet | Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) |
| Citations for Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) – 1 Found |
| McElreavey, Ken; Jorgensen, Anne; Eozenou, Caroline; Merel, Tiphanie; Bignon-Topalovic, Joelle; Tan, Daisylyn Senna; Houzelstein, Denis; Buonocore, Federica; Warr, Nick; Kay, Raissa G G; Peycelon, Matthieu; Siffroi, Jean-Pierre; Mazen, Inas; Achermann, John C; Shcherbak, Yuliya; Leger, Juliane; Sallai, Agnes; Carel, Jean-Claude; Martinerie, Laetitia; Le Ru, Romain; Conway, Gerard S; Mignot, Brigitte; Van Maldergem, Lionel; Bertalan, Rita; Globa, Evgenia; Brauner, Raja; Jauch, Ralf; Nef, Serge; Greenfield, Andy; Bashamboo, Anu. Pathogenic variants in the DEAH-box RNA helicase DHX37 are a frequent cause of 46,XY gonadal dysgenesis and 46,XY testicular regression syndrome. Genetics In Medicine : Official Journal Of The American College Of Medical Genetics. 2020;22(1):150-159. PubMed |