Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA047607-25

Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 37
Gene Name: DHX37
Alternative Gene Name: DDX37, KIAA1517, MGC2695, MGC4322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029480: 87%, ENSRNOG00000022171: 87%
Entrez Gene ID: 57647
Uniprot ID: Q8IY37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLD
• Gene Sequence: VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLD
• Gene ID - Mouse: ENSMUSG00000029480
• Gene ID - Rat: ENSRNOG00000022171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DHX37 pAb (ATL-HPA047607 w/enhanced validation) – 1 Found

McElreavey, Ken; Jorgensen, Anne; Eozenou, Caroline; Merel, Tiphanie; Bignon-Topalovic, Joelle; Tan, Daisylyn Senna; Houzelstein, Denis; Buonocore, Federica; Warr, Nick; Kay, Raissa G G; Peycelon, Matthieu; Siffroi, Jean-Pierre; Mazen, Inas; Achermann, John C; Shcherbak, Yuliya; Leger, Juliane; Sallai, Agnes; Carel, Jean-Claude; Martinerie, Laetitia; Le Ru, Romain; Conway, Gerard S; Mignot, Brigitte; Van Maldergem, Lionel; Bertalan, Rita; Globa, Evgenia; Brauner, Raja; Jauch, Ralf; Nef, Serge; Greenfield, Andy; Bashamboo, Anu. Pathogenic variants in the DEAH-box RNA helicase DHX37 are a frequent cause of 46,XY gonadal dysgenesis and 46,XY testicular regression syndrome. Genetics In Medicine : Official Journal Of The American College Of Medical Genetics. 2020;22(1):150-159.