Anti DHX36 pAb (ATL-HPA035399)

Atlas Antibodies

Catalog No.: ATL-HPA035399-25

Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 36
Gene Name: DHX36
Alternative Gene Name: DDX36, KIAA1488, MLEL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027770: 80%, ENSRNOG00000014599: 79%
Entrez Gene ID: 170506
Uniprot ID: Q9H2U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
• Gene Sequence: ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
• Gene ID - Mouse: ENSMUSG00000027770
• Gene ID - Rat: ENSRNOG00000014599
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.