Anti DHX36 pAb (ATL-HPA035399)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035399-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DHX36
Alternative Gene Name: DDX36, KIAA1488, MLEL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027770: 80%, ENSRNOG00000014599: 79%
Entrez Gene ID: 170506
Uniprot ID: Q9H2U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT |
| Gene Sequence | ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT |
| Gene ID - Mouse | ENSMUSG00000027770 |
| Gene ID - Rat | ENSRNOG00000014599 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHX36 pAb (ATL-HPA035399) | |
| Datasheet | Anti DHX36 pAb (ATL-HPA035399) Datasheet (External Link) |
| Vendor Page | Anti DHX36 pAb (ATL-HPA035399) at Atlas Antibodies |
| Documents & Links for Anti DHX36 pAb (ATL-HPA035399) | |
| Datasheet | Anti DHX36 pAb (ATL-HPA035399) Datasheet (External Link) |
| Vendor Page | Anti DHX36 pAb (ATL-HPA035399) |