Anti DHX36 pAb (ATL-HPA035399)

Atlas Antibodies

SKU:
ATL-HPA035399-25
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 36
Gene Name: DHX36
Alternative Gene Name: DDX36, KIAA1488, MLEL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027770: 80%, ENSRNOG00000014599: 79%
Entrez Gene ID: 170506
Uniprot ID: Q9H2U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
Gene Sequence ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT
Gene ID - Mouse ENSMUSG00000027770
Gene ID - Rat ENSRNOG00000014599
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX36 pAb (ATL-HPA035399)
Datasheet Anti DHX36 pAb (ATL-HPA035399) Datasheet (External Link)
Vendor Page Anti DHX36 pAb (ATL-HPA035399) at Atlas Antibodies

Documents & Links for Anti DHX36 pAb (ATL-HPA035399)
Datasheet Anti DHX36 pAb (ATL-HPA035399) Datasheet (External Link)
Vendor Page Anti DHX36 pAb (ATL-HPA035399)