Anti DHX34 pAb (ATL-HPA042159)

Atlas Antibodies

SKU:
ATL-HPA042159-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 34
Gene Name: DHX34
Alternative Gene Name: DDX34, KIAA0134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006019: 87%, ENSRNOG00000047575: 88%
Entrez Gene ID: 9704
Uniprot ID: Q14147
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYDPRYRINLSVLGPATRGSQGLGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
Gene Sequence TYDPRYRINLSVLGPATRGSQGLGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
Gene ID - Mouse ENSMUSG00000006019
Gene ID - Rat ENSRNOG00000047575
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX34 pAb (ATL-HPA042159)
Datasheet Anti DHX34 pAb (ATL-HPA042159) Datasheet (External Link)
Vendor Page Anti DHX34 pAb (ATL-HPA042159) at Atlas Antibodies

Documents & Links for Anti DHX34 pAb (ATL-HPA042159)
Datasheet Anti DHX34 pAb (ATL-HPA042159) Datasheet (External Link)
Vendor Page Anti DHX34 pAb (ATL-HPA042159)