Anti DHX33 pAb (ATL-HPA073875)

Atlas Antibodies

Catalog No.: ATL-HPA073875-25

Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 33
Gene Name: DHX33
Alternative Gene Name: DDX33, DKFZp762F2011, FLJ21972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040620: 93%, ENSRNOG00000007054: 93%
Entrez Gene ID: 56919
Uniprot ID: Q9H6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMS
• Gene Sequence: ASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMS
• Gene ID - Mouse: ENSMUSG00000040620
• Gene ID - Rat: ENSRNOG00000007054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.