Anti DHX33 pAb (ATL-HPA073875)

Atlas Antibodies

SKU:
ATL-HPA073875-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 33
Gene Name: DHX33
Alternative Gene Name: DDX33, DKFZp762F2011, FLJ21972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040620: 93%, ENSRNOG00000007054: 93%
Entrez Gene ID: 56919
Uniprot ID: Q9H6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMS
Gene Sequence ASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGALEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMS
Gene ID - Mouse ENSMUSG00000040620
Gene ID - Rat ENSRNOG00000007054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHX33 pAb (ATL-HPA073875)
Datasheet Anti DHX33 pAb (ATL-HPA073875) Datasheet (External Link)
Vendor Page Anti DHX33 pAb (ATL-HPA073875) at Atlas Antibodies

Documents & Links for Anti DHX33 pAb (ATL-HPA073875)
Datasheet Anti DHX33 pAb (ATL-HPA073875) Datasheet (External Link)
Vendor Page Anti DHX33 pAb (ATL-HPA073875)