Anti DHX32 pAb (ATL-HPA048872)

Atlas Antibodies

Catalog No.:
ATL-HPA048872-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 32
Gene Name: DHX32
Alternative Gene Name: DDX32, DHLP1, FLJ10694, FLJ10889
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030986: 82%, ENSRNOG00000018119: 81%
Entrez Gene ID: 55760
Uniprot ID: Q7L7V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR
Gene Sequence EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR
Gene ID - Mouse ENSMUSG00000030986
Gene ID - Rat ENSRNOG00000018119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHX32 pAb (ATL-HPA048872)
Datasheet Anti DHX32 pAb (ATL-HPA048872) Datasheet (External Link)
Vendor Page Anti DHX32 pAb (ATL-HPA048872) at Atlas Antibodies

Documents & Links for Anti DHX32 pAb (ATL-HPA048872)
Datasheet Anti DHX32 pAb (ATL-HPA048872) Datasheet (External Link)
Vendor Page Anti DHX32 pAb (ATL-HPA048872)