Anti DHX32 pAb (ATL-HPA048872)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048872-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DHX32
Alternative Gene Name: DDX32, DHLP1, FLJ10694, FLJ10889
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030986: 82%, ENSRNOG00000018119: 81%
Entrez Gene ID: 55760
Uniprot ID: Q7L7V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR |
| Gene Sequence | EKGDIVVFLACEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERR |
| Gene ID - Mouse | ENSMUSG00000030986 |
| Gene ID - Rat | ENSRNOG00000018119 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHX32 pAb (ATL-HPA048872) | |
| Datasheet | Anti DHX32 pAb (ATL-HPA048872) Datasheet (External Link) |
| Vendor Page | Anti DHX32 pAb (ATL-HPA048872) at Atlas Antibodies |
| Documents & Links for Anti DHX32 pAb (ATL-HPA048872) | |
| Datasheet | Anti DHX32 pAb (ATL-HPA048872) Datasheet (External Link) |
| Vendor Page | Anti DHX32 pAb (ATL-HPA048872) |