Anti DHX30 pAb (ATL-HPA034806)

Atlas Antibodies

Catalog No.:
ATL-HPA034806-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box helicase 30
Gene Name: DHX30
Alternative Gene Name: DDX30, FLJ11214, KIAA0890
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032480: 100%, ENSRNOG00000029194: 100%
Entrez Gene ID: 22907
Uniprot ID: Q7L2E3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPA
Gene Sequence ISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPA
Gene ID - Mouse ENSMUSG00000032480
Gene ID - Rat ENSRNOG00000029194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHX30 pAb (ATL-HPA034806)
Datasheet Anti DHX30 pAb (ATL-HPA034806) Datasheet (External Link)
Vendor Page Anti DHX30 pAb (ATL-HPA034806) at Atlas Antibodies

Documents & Links for Anti DHX30 pAb (ATL-HPA034806)
Datasheet Anti DHX30 pAb (ATL-HPA034806) Datasheet (External Link)
Vendor Page Anti DHX30 pAb (ATL-HPA034806)