Anti DHX29 pAb (ATL-HPA038317)
Atlas Antibodies
- SKU:
- ATL-HPA038317-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: DHX29
Alternative Gene Name: DDX29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042426: 94%, ENSRNOG00000010369: 95%
Entrez Gene ID: 54505
Uniprot ID: Q7Z478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK |
Gene Sequence | LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK |
Gene ID - Mouse | ENSMUSG00000042426 |
Gene ID - Rat | ENSRNOG00000010369 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DHX29 pAb (ATL-HPA038317) | |
Datasheet | Anti DHX29 pAb (ATL-HPA038317) Datasheet (External Link) |
Vendor Page | Anti DHX29 pAb (ATL-HPA038317) at Atlas Antibodies |
Documents & Links for Anti DHX29 pAb (ATL-HPA038317) | |
Datasheet | Anti DHX29 pAb (ATL-HPA038317) Datasheet (External Link) |
Vendor Page | Anti DHX29 pAb (ATL-HPA038317) |