Anti DHX29 pAb (ATL-HPA038317)

Atlas Antibodies

Catalog No.:
ATL-HPA038317-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 29
Gene Name: DHX29
Alternative Gene Name: DDX29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042426: 94%, ENSRNOG00000010369: 95%
Entrez Gene ID: 54505
Uniprot ID: Q7Z478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
Gene Sequence LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
Gene ID - Mouse ENSMUSG00000042426
Gene ID - Rat ENSRNOG00000010369
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHX29 pAb (ATL-HPA038317)
Datasheet Anti DHX29 pAb (ATL-HPA038317) Datasheet (External Link)
Vendor Page Anti DHX29 pAb (ATL-HPA038317) at Atlas Antibodies

Documents & Links for Anti DHX29 pAb (ATL-HPA038317)
Datasheet Anti DHX29 pAb (ATL-HPA038317) Datasheet (External Link)
Vendor Page Anti DHX29 pAb (ATL-HPA038317)