Anti DHX29 pAb (ATL-HPA038317)

Atlas Antibodies

Catalog No.: ATL-HPA038317-100

Protein Description: DEAH (Asp-Glu-Ala-His) box polypeptide 29
Gene Name: DHX29
Alternative Gene Name: DDX29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042426: 94%, ENSRNOG00000010369: 95%
Entrez Gene ID: 54505
Uniprot ID: Q7Z478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
• Gene Sequence: LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
• Gene ID - Mouse: ENSMUSG00000042426
• Gene ID - Rat: ENSRNOG00000010369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.