Anti DHX15 pAb (ATL-HPA047047)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047047-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DHX15
Alternative Gene Name: DBP1, DDX15, HRH2, PRP43, PRPF43, PrPp43p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029169: 98%, ENSRNOG00000003844: 99%
Entrez Gene ID: 1665
Uniprot ID: O43143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD |
| Gene Sequence | RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD |
| Gene ID - Mouse | ENSMUSG00000029169 |
| Gene ID - Rat | ENSRNOG00000003844 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHX15 pAb (ATL-HPA047047) | |
| Datasheet | Anti DHX15 pAb (ATL-HPA047047) Datasheet (External Link) |
| Vendor Page | Anti DHX15 pAb (ATL-HPA047047) at Atlas Antibodies |
| Documents & Links for Anti DHX15 pAb (ATL-HPA047047) | |
| Datasheet | Anti DHX15 pAb (ATL-HPA047047) Datasheet (External Link) |
| Vendor Page | Anti DHX15 pAb (ATL-HPA047047) |
| Citations for Anti DHX15 pAb (ATL-HPA047047) – 1 Found |
| Zhang, Sunyuan; Hinde, Elizabeth; Parkyn Schneider, Molly; Jans, David A; Bogoyevitch, Marie A. Nuclear bodies formed by polyQ-ataxin-1 protein are liquid RNA/protein droplets with tunable dynamics. Scientific Reports. 2020;10(1):1557. PubMed |