Anti DHX15 pAb (ATL-HPA047047)

Atlas Antibodies

Catalog No.:
ATL-HPA047047-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box helicase 15
Gene Name: DHX15
Alternative Gene Name: DBP1, DDX15, HRH2, PRP43, PRPF43, PrPp43p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029169: 98%, ENSRNOG00000003844: 99%
Entrez Gene ID: 1665
Uniprot ID: O43143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD
Gene Sequence RASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKD
Gene ID - Mouse ENSMUSG00000029169
Gene ID - Rat ENSRNOG00000003844
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHX15 pAb (ATL-HPA047047)
Datasheet Anti DHX15 pAb (ATL-HPA047047) Datasheet (External Link)
Vendor Page Anti DHX15 pAb (ATL-HPA047047) at Atlas Antibodies

Documents & Links for Anti DHX15 pAb (ATL-HPA047047)
Datasheet Anti DHX15 pAb (ATL-HPA047047) Datasheet (External Link)
Vendor Page Anti DHX15 pAb (ATL-HPA047047)
Citations for Anti DHX15 pAb (ATL-HPA047047) – 1 Found
Zhang, Sunyuan; Hinde, Elizabeth; Parkyn Schneider, Molly; Jans, David A; Bogoyevitch, Marie A. Nuclear bodies formed by polyQ-ataxin-1 protein are liquid RNA/protein droplets with tunable dynamics. Scientific Reports. 2020;10(1):1557.  PubMed