Anti DHTKD1 pAb (ATL-HPA066098)

Atlas Antibodies

Catalog No.:
ATL-HPA066098-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dehydrogenase E1 and transketolase domain containing 1
Gene Name: DHTKD1
Alternative Gene Name: CMT2Q, DKFZP762M115, KIAA1630, MGC3090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025815: 84%, ENSRNOG00000062048: 89%
Entrez Gene ID: 55526
Uniprot ID: Q96HY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA
Gene Sequence LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA
Gene ID - Mouse ENSMUSG00000025815
Gene ID - Rat ENSRNOG00000062048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHTKD1 pAb (ATL-HPA066098)
Datasheet Anti DHTKD1 pAb (ATL-HPA066098) Datasheet (External Link)
Vendor Page Anti DHTKD1 pAb (ATL-HPA066098) at Atlas Antibodies

Documents & Links for Anti DHTKD1 pAb (ATL-HPA066098)
Datasheet Anti DHTKD1 pAb (ATL-HPA066098) Datasheet (External Link)
Vendor Page Anti DHTKD1 pAb (ATL-HPA066098)