Anti DHTKD1 pAb (ATL-HPA066098)

Atlas Antibodies

Catalog No.: ATL-HPA066098-25

Protein Description: dehydrogenase E1 and transketolase domain containing 1
Gene Name: DHTKD1
Alternative Gene Name: CMT2Q, DKFZP762M115, KIAA1630, MGC3090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025815: 84%, ENSRNOG00000062048: 89%
Entrez Gene ID: 55526
Uniprot ID: Q96HY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA
• Gene Sequence: LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA
• Gene ID - Mouse: ENSMUSG00000025815
• Gene ID - Rat: ENSRNOG00000062048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.