Anti DHTKD1 pAb (ATL-HPA037950)

Atlas Antibodies

SKU: ATL-HPA037950-25

• 
• 

Protein Description: dehydrogenase E1 and transketolase domain containing 1
Gene Name: DHTKD1
Alternative Gene Name: DKFZP762M115, KIAA1630, MGC3090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025815: 75%, ENSRNOG00000062048: 74%
Entrez Gene ID: 55526
Uniprot ID: Q96HY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG
• Gene Sequence: EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG
• Gene ID - Mouse: ENSMUSG00000025815
• Gene ID - Rat: ENSRNOG00000062048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DHTKD1 pAb (ATL-HPA037950) – 1 Found

Sherrill, Joseph D; Kc, Kiran; Wang, Xinjian; Wen, Ting; Chamberlin, Adam; Stucke, Emily M; Collins, Margaret H; Abonia, J Pablo; Peng, Yanyan; Wu, Qiang; Putnam, Philip E; Dexheimer, Phillip J; Aronow, Bruce J; Kottyan, Leah C; Kaufman, Kenneth M; Harley, John B; Huang, Taosheng; Rothenberg, Marc E. Whole-exome sequencing uncovers oxidoreductases DHTKD1 and OGDHL as linkers between mitochondrial dysfunction and eosinophilic esophagitis. Jci Insight. 2018;3(8)