Anti DHRSX pAb (ATL-HPA075955)

Atlas Antibodies

SKU: ATL-HPA075955-25

• 

Protein Description: dehydrogenase/reductase X-linked
Gene Name: DHRSX
Alternative Gene Name: DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063897: 60%, ENSRNOG00000028323: 44%
Entrez Gene ID: 207063
Uniprot ID: Q8N5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLAL
• Gene Sequence: LDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLAL
• Gene ID - Mouse: ENSMUSG00000063897
• Gene ID - Rat: ENSRNOG00000028323
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.