Anti DHRSX pAb (ATL-HPA003035)

Atlas Antibodies

Catalog No.:
ATL-HPA003035-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase (SDR family) X-linked
Gene Name: DHRSX
Alternative Gene Name: DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063897: 57%, ENSRNOG00000028323: 54%
Entrez Gene ID: 207063
Uniprot ID: Q8N5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDK
Gene Sequence PRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDK
Gene ID - Mouse ENSMUSG00000063897
Gene ID - Rat ENSRNOG00000028323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHRSX pAb (ATL-HPA003035)
Datasheet Anti DHRSX pAb (ATL-HPA003035) Datasheet (External Link)
Vendor Page Anti DHRSX pAb (ATL-HPA003035) at Atlas Antibodies

Documents & Links for Anti DHRSX pAb (ATL-HPA003035)
Datasheet Anti DHRSX pAb (ATL-HPA003035) Datasheet (External Link)
Vendor Page Anti DHRSX pAb (ATL-HPA003035)