Anti DHRS9 pAb (ATL-HPA036667)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036667-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: DHRS9
Alternative Gene Name: 3alpha-HSD, RDH15, RDHL, RETSDR8, SDR9C4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027068: 85%, ENSRNOG00000058568: 85%
Entrez Gene ID: 10170
Uniprot ID: Q9BPW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKA |
| Gene Sequence | KSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKA |
| Gene ID - Mouse | ENSMUSG00000027068 |
| Gene ID - Rat | ENSRNOG00000058568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHRS9 pAb (ATL-HPA036667) | |
| Datasheet | Anti DHRS9 pAb (ATL-HPA036667) Datasheet (External Link) |
| Vendor Page | Anti DHRS9 pAb (ATL-HPA036667) at Atlas Antibodies |
| Documents & Links for Anti DHRS9 pAb (ATL-HPA036667) | |
| Datasheet | Anti DHRS9 pAb (ATL-HPA036667) Datasheet (External Link) |
| Vendor Page | Anti DHRS9 pAb (ATL-HPA036667) |