Anti DHRS9 pAb (ATL-HPA036667)

Atlas Antibodies

SKU: ATL-HPA036667-100

• 
• 

Protein Description: dehydrogenase/reductase (SDR family) member 9
Gene Name: DHRS9
Alternative Gene Name: 3alpha-HSD, RDH15, RDHL, RETSDR8, SDR9C4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027068: 85%, ENSRNOG00000058568: 85%
Entrez Gene ID: 10170
Uniprot ID: Q9BPW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKA
• Gene Sequence: KSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKA
• Gene ID - Mouse: ENSMUSG00000027068
• Gene ID - Rat: ENSRNOG00000058568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.