Anti DHRS7 pAb (ATL-HPA031121)

Atlas Antibodies

SKU:
ATL-HPA031121-25
  • Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
  • Western blot analysis in human cell line A-431.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase (SDR family) member 7
Gene Name: DHRS7
Alternative Gene Name: retDSR4, SDR34C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021094: 90%, ENSRNOG00000005589: 85%
Entrez Gene ID: 51635
Uniprot ID: Q9Y394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMI
Gene Sequence DLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMI
Gene ID - Mouse ENSMUSG00000021094
Gene ID - Rat ENSRNOG00000005589
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHRS7 pAb (ATL-HPA031121)
Datasheet Anti DHRS7 pAb (ATL-HPA031121) Datasheet (External Link)
Vendor Page Anti DHRS7 pAb (ATL-HPA031121) at Atlas Antibodies

Documents & Links for Anti DHRS7 pAb (ATL-HPA031121)
Datasheet Anti DHRS7 pAb (ATL-HPA031121) Datasheet (External Link)
Vendor Page Anti DHRS7 pAb (ATL-HPA031121)



Citations for Anti DHRS7 pAb (ATL-HPA031121) – 1 Found
Seibert, Julia K; Quagliata, Luca; Quintavalle, Cristina; Hammond, Thomas G; Terracciano, Luigi; Odermatt, Alex. A role for the dehydrogenase DHRS7 (SDR34C1) in prostate cancer. Cancer Medicine. 2015;4(11):1717-29.  PubMed