Anti DHRS3 pAb (ATL-HPA010844)

Atlas Antibodies

Catalog No.:
ATL-HPA010844-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase (SDR family) member 3
Gene Name: DHRS3
Alternative Gene Name: RDH17, retSDR1, Rsdr1, SDR1, SDR16C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066026: 98%, ENSRNOG00000015736: 98%
Entrez Gene ID: 9249
Uniprot ID: O75911
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG
Gene Sequence TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG
Gene ID - Mouse ENSMUSG00000066026
Gene ID - Rat ENSRNOG00000015736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHRS3 pAb (ATL-HPA010844)
Datasheet Anti DHRS3 pAb (ATL-HPA010844) Datasheet (External Link)
Vendor Page Anti DHRS3 pAb (ATL-HPA010844) at Atlas Antibodies

Documents & Links for Anti DHRS3 pAb (ATL-HPA010844)
Datasheet Anti DHRS3 pAb (ATL-HPA010844) Datasheet (External Link)
Vendor Page Anti DHRS3 pAb (ATL-HPA010844)
Citations for Anti DHRS3 pAb (ATL-HPA010844) – 1 Found
Deisenroth, Chad; Itahana, Yoko; Tollini, Laura; Jin, Aiwen; Zhang, Yanping. p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation. The Journal Of Biological Chemistry. 2011;286(32):28343-56.  PubMed