Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA069551-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase (SDR family) member 2
Gene Name: DHRS2
Alternative Gene Name: HEP27, SDR25C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022209: 80%, ENSRNOG00000018177: 80%
Entrez Gene ID: 10202
Uniprot ID: Q13268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Gene Sequence EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Gene ID - Mouse ENSMUSG00000022209
Gene ID - Rat ENSRNOG00000018177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation)
Datasheet Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation)
Datasheet Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation)