Anti DHRS13 pAb (ATL-HPA022991)

Atlas Antibodies

Catalog No.:
ATL-HPA022991-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase (SDR family) member 13
Gene Name: DHRS13
Alternative Gene Name: MGC23280, SDR7C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020834: 57%, ENSRNOG00000009673: 51%
Entrez Gene ID: 147015
Uniprot ID: Q6UX07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
Gene Sequence AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
Gene ID - Mouse ENSMUSG00000020834
Gene ID - Rat ENSRNOG00000009673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHRS13 pAb (ATL-HPA022991)
Datasheet Anti DHRS13 pAb (ATL-HPA022991) Datasheet (External Link)
Vendor Page Anti DHRS13 pAb (ATL-HPA022991) at Atlas Antibodies

Documents & Links for Anti DHRS13 pAb (ATL-HPA022991)
Datasheet Anti DHRS13 pAb (ATL-HPA022991) Datasheet (External Link)
Vendor Page Anti DHRS13 pAb (ATL-HPA022991)