Anti DHRS13 pAb (ATL-HPA022991)

Atlas Antibodies

SKU: ATL-HPA022991-25

• 
• 
• 

Protein Description: dehydrogenase/reductase (SDR family) member 13
Gene Name: DHRS13
Alternative Gene Name: MGC23280, SDR7C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020834: 57%, ENSRNOG00000009673: 51%
Entrez Gene ID: 147015
Uniprot ID: Q6UX07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
• Gene Sequence: AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
• Gene ID - Mouse: ENSMUSG00000020834
• Gene ID - Rat: ENSRNOG00000009673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.