Anti DHRS13 pAb (ATL-HPA022991)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022991-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DHRS13
Alternative Gene Name: MGC23280, SDR7C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020834: 57%, ENSRNOG00000009673: 51%
Entrez Gene ID: 147015
Uniprot ID: Q6UX07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS |
| Gene Sequence | AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS |
| Gene ID - Mouse | ENSMUSG00000020834 |
| Gene ID - Rat | ENSRNOG00000009673 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHRS13 pAb (ATL-HPA022991) | |
| Datasheet | Anti DHRS13 pAb (ATL-HPA022991) Datasheet (External Link) |
| Vendor Page | Anti DHRS13 pAb (ATL-HPA022991) at Atlas Antibodies |
| Documents & Links for Anti DHRS13 pAb (ATL-HPA022991) | |
| Datasheet | Anti DHRS13 pAb (ATL-HPA022991) Datasheet (External Link) |
| Vendor Page | Anti DHRS13 pAb (ATL-HPA022991) |