Anti DHRS12 pAb (ATL-HPA058315)

Atlas Antibodies

Catalog No.:
ATL-HPA058315-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase (SDR family) member 12
Gene Name: DHRS12
Alternative Gene Name: FLJ13639, SDR40C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056608: 26%, ENSRNOG00000011709: 26%
Entrez Gene ID: 79758
Uniprot ID: A0PJE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLHVKTLSLMTWRSRFLEESFWSLEETAALAKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHKLHVLI
Gene Sequence NLHVKTLSLMTWRSRFLEESFWSLEETAALAKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHKLHVLI
Gene ID - Mouse ENSMUSG00000056608
Gene ID - Rat ENSRNOG00000011709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHRS12 pAb (ATL-HPA058315)
Datasheet Anti DHRS12 pAb (ATL-HPA058315) Datasheet (External Link)
Vendor Page Anti DHRS12 pAb (ATL-HPA058315) at Atlas Antibodies

Documents & Links for Anti DHRS12 pAb (ATL-HPA058315)
Datasheet Anti DHRS12 pAb (ATL-HPA058315) Datasheet (External Link)
Vendor Page Anti DHRS12 pAb (ATL-HPA058315)