Anti DHRS1 pAb (ATL-HPA076886)

Atlas Antibodies

Catalog No.: ATL-HPA076886-25

Protein Description: dehydrogenase/reductase 1
Gene Name: DHRS1
Alternative Gene Name: FLJ25430, MGC20204, SDR19C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002332: 93%, ENSRNOG00000020264: 93%
Entrez Gene ID: 115817
Uniprot ID: Q96LJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDV
• Gene Sequence: GIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDV
• Gene ID - Mouse: ENSMUSG00000002332
• Gene ID - Rat: ENSRNOG00000020264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.