Anti DHRS1 pAb (ATL-HPA076886)

Atlas Antibodies

Catalog No.:
ATL-HPA076886-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dehydrogenase/reductase 1
Gene Name: DHRS1
Alternative Gene Name: FLJ25430, MGC20204, SDR19C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002332: 93%, ENSRNOG00000020264: 93%
Entrez Gene ID: 115817
Uniprot ID: Q96LJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDV
Gene Sequence GIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDV
Gene ID - Mouse ENSMUSG00000002332
Gene ID - Rat ENSRNOG00000020264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHRS1 pAb (ATL-HPA076886)
Datasheet Anti DHRS1 pAb (ATL-HPA076886) Datasheet (External Link)
Vendor Page Anti DHRS1 pAb (ATL-HPA076886) at Atlas Antibodies

Documents & Links for Anti DHRS1 pAb (ATL-HPA076886)
Datasheet Anti DHRS1 pAb (ATL-HPA076886) Datasheet (External Link)
Vendor Page Anti DHRS1 pAb (ATL-HPA076886)