Anti DHODH pAb (ATL-HPA011942)

Atlas Antibodies

SKU:
ATL-HPA011942-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic granular positivity in hepatocytes.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dihydroorotate dehydrogenase (quinone)
Gene Name: DHODH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031730: 92%, ENSRNOG00000015063: 92%
Entrez Gene ID: 1723
Uniprot ID: Q02127
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRG
Gene Sequence LAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRG
Gene ID - Mouse ENSMUSG00000031730
Gene ID - Rat ENSRNOG00000015063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHODH pAb (ATL-HPA011942)
Datasheet Anti DHODH pAb (ATL-HPA011942) Datasheet (External Link)
Vendor Page Anti DHODH pAb (ATL-HPA011942) at Atlas Antibodies

Documents & Links for Anti DHODH pAb (ATL-HPA011942)
Datasheet Anti DHODH pAb (ATL-HPA011942) Datasheet (External Link)
Vendor Page Anti DHODH pAb (ATL-HPA011942)