Anti DHFR2 pAb (ATL-HPA051465)

Atlas Antibodies

Catalog No.:
ATL-HPA051465-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dihydrofolate reductase 2
Gene Name: DHFR2
Alternative Gene Name: DHFRL1, DHFRP4, FLJ16119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021707: 97%, ENSRNOG00000013521: 93%
Entrez Gene ID: 200895
Uniprot ID: Q86XF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLRNEFRYFQRMTTTSSVEGKQNLVIMGRK
Gene Sequence PLRNEFRYFQRMTTTSSVEGKQNLVIMGRK
Gene ID - Mouse ENSMUSG00000021707
Gene ID - Rat ENSRNOG00000013521
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHFR2 pAb (ATL-HPA051465)
Datasheet Anti DHFR2 pAb (ATL-HPA051465) Datasheet (External Link)
Vendor Page Anti DHFR2 pAb (ATL-HPA051465) at Atlas Antibodies

Documents & Links for Anti DHFR2 pAb (ATL-HPA051465)
Datasheet Anti DHFR2 pAb (ATL-HPA051465) Datasheet (External Link)
Vendor Page Anti DHFR2 pAb (ATL-HPA051465)