Anti DHFR2 pAb (ATL-HPA051465)

Atlas Antibodies

Catalog No.: ATL-HPA051465-25

Protein Description: dihydrofolate reductase 2
Gene Name: DHFR2
Alternative Gene Name: DHFRL1, DHFRP4, FLJ16119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021707: 97%, ENSRNOG00000013521: 93%
Entrez Gene ID: 200895
Uniprot ID: Q86XF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLRNEFRYFQRMTTTSSVEGKQNLVIMGRK
• Gene Sequence: PLRNEFRYFQRMTTTSSVEGKQNLVIMGRK
• Gene ID - Mouse: ENSMUSG00000021707
• Gene ID - Rat: ENSRNOG00000013521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.