Anti DHDDS pAb (ATL-HPA026727)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026727-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DHDDS
Alternative Gene Name: DS, FLJ13102, HDS, RP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012117: 88%, ENSRNOG00000014665: 89%
Entrez Gene ID: 79947
Uniprot ID: Q86SQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA |
| Gene Sequence | HSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA |
| Gene ID - Mouse | ENSMUSG00000012117 |
| Gene ID - Rat | ENSRNOG00000014665 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHDDS pAb (ATL-HPA026727) | |
| Datasheet | Anti DHDDS pAb (ATL-HPA026727) Datasheet (External Link) |
| Vendor Page | Anti DHDDS pAb (ATL-HPA026727) at Atlas Antibodies |
| Documents & Links for Anti DHDDS pAb (ATL-HPA026727) | |
| Datasheet | Anti DHDDS pAb (ATL-HPA026727) Datasheet (External Link) |
| Vendor Page | Anti DHDDS pAb (ATL-HPA026727) |
| Citations for Anti DHDDS pAb (ATL-HPA026727) – 2 Found |
| Zelinger, Lina; Banin, Eyal; Obolensky, Alexey; Mizrahi-Meissonnier, Liliana; Beryozkin, Avigail; Bandah-Rozenfeld, Dikla; Frenkel, Shahar; Ben-Yosef, Tamar; Merin, Saul; Schwartz, Sharon B; Cideciyan, Artur V; Jacobson, Samuel G; Sharon, Dror. A missense mutation in DHDDS, encoding dehydrodolichyl diphosphate synthase, is associated with autosomal-recessive retinitis pigmentosa in Ashkenazi Jews. American Journal Of Human Genetics. 2011;88(2):207-15. PubMed |
| Courage, Carolina; Oliver, Karen L; Park, Eon Joo; Cameron, Jillian M; Grabińska, Kariona A; Muona, Mikko; Canafoglia, Laura; Gambardella, Antonio; Said, Edith; Afawi, Zaid; Baykan, Betul; Brandt, Christian; di Bonaventura, Carlo; Chew, Hui Bein; Criscuolo, Chiara; Dibbens, Leanne M; Castellotti, Barbara; Riguzzi, Patrizia; Labate, Angelo; Filla, Alessandro; Giallonardo, Anna T; Berecki, Geza; Jackson, Christopher B; Joensuu, Tarja; Damiano, John A; Kivity, Sara; Korczyn, Amos; Palotie, Aarno; Striano, Pasquale; Uccellini, Davide; Giuliano, Loretta; Andermann, Eva; Scheffer, Ingrid E; Michelucci, Roberto; Bahlo, Melanie; Franceschetti, Silvana; Sessa, William C; Berkovic, Samuel F; Lehesjoki, Anna-Elina. Progressive myoclonus epilepsies-Residual unsolved cases have marked genetic heterogeneity including dolichol-dependent protein glycosylation pathway genes. American Journal Of Human Genetics. 2021;108(4):722-738. PubMed |