Anti DHDDS pAb (ATL-HPA026721)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026721-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DHDDS
Alternative Gene Name: DS, FLJ13102, HDS, RP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012117: 91%, ENSRNOG00000014665: 91%
Entrez Gene ID: 79947
Uniprot ID: Q86SQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA |
| Gene Sequence | RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA |
| Gene ID - Mouse | ENSMUSG00000012117 |
| Gene ID - Rat | ENSRNOG00000014665 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHDDS pAb (ATL-HPA026721) | |
| Datasheet | Anti DHDDS pAb (ATL-HPA026721) Datasheet (External Link) |
| Vendor Page | Anti DHDDS pAb (ATL-HPA026721) at Atlas Antibodies |
| Documents & Links for Anti DHDDS pAb (ATL-HPA026721) | |
| Datasheet | Anti DHDDS pAb (ATL-HPA026721) Datasheet (External Link) |
| Vendor Page | Anti DHDDS pAb (ATL-HPA026721) |
| Citations for Anti DHDDS pAb (ATL-HPA026721) – 1 Found |
| Zelinger, Lina; Banin, Eyal; Obolensky, Alexey; Mizrahi-Meissonnier, Liliana; Beryozkin, Avigail; Bandah-Rozenfeld, Dikla; Frenkel, Shahar; Ben-Yosef, Tamar; Merin, Saul; Schwartz, Sharon B; Cideciyan, Artur V; Jacobson, Samuel G; Sharon, Dror. A missense mutation in DHDDS, encoding dehydrodolichyl diphosphate synthase, is associated with autosomal-recessive retinitis pigmentosa in Ashkenazi Jews. American Journal Of Human Genetics. 2011;88(2):207-15. PubMed |