Anti DHDDS pAb (ATL-HPA026721)

Atlas Antibodies

Catalog No.:
ATL-HPA026721-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dehydrodolichyl diphosphate synthase
Gene Name: DHDDS
Alternative Gene Name: DS, FLJ13102, HDS, RP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012117: 91%, ENSRNOG00000014665: 91%
Entrez Gene ID: 79947
Uniprot ID: Q86SQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA
Gene Sequence RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA
Gene ID - Mouse ENSMUSG00000012117
Gene ID - Rat ENSRNOG00000014665
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHDDS pAb (ATL-HPA026721)
Datasheet Anti DHDDS pAb (ATL-HPA026721) Datasheet (External Link)
Vendor Page Anti DHDDS pAb (ATL-HPA026721) at Atlas Antibodies

Documents & Links for Anti DHDDS pAb (ATL-HPA026721)
Datasheet Anti DHDDS pAb (ATL-HPA026721) Datasheet (External Link)
Vendor Page Anti DHDDS pAb (ATL-HPA026721)
Citations for Anti DHDDS pAb (ATL-HPA026721) – 1 Found
Zelinger, Lina; Banin, Eyal; Obolensky, Alexey; Mizrahi-Meissonnier, Liliana; Beryozkin, Avigail; Bandah-Rozenfeld, Dikla; Frenkel, Shahar; Ben-Yosef, Tamar; Merin, Saul; Schwartz, Sharon B; Cideciyan, Artur V; Jacobson, Samuel G; Sharon, Dror. A missense mutation in DHDDS, encoding dehydrodolichyl diphosphate synthase, is associated with autosomal-recessive retinitis pigmentosa in Ashkenazi Jews. American Journal Of Human Genetics. 2011;88(2):207-15.  PubMed