Anti DHCR7 pAb (ATL-HPA044280)

Atlas Antibodies

SKU:
ATL-HPA044280-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 7-dehydrocholesterol reductase
Gene Name: DHCR7
Alternative Gene Name: SLOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058454: 92%, ENSRNOG00000020776: 88%
Entrez Gene ID: 1717
Uniprot ID: Q9UBM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMG
Gene Sequence HQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMG
Gene ID - Mouse ENSMUSG00000058454
Gene ID - Rat ENSRNOG00000020776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DHCR7 pAb (ATL-HPA044280)
Datasheet Anti DHCR7 pAb (ATL-HPA044280) Datasheet (External Link)
Vendor Page Anti DHCR7 pAb (ATL-HPA044280) at Atlas Antibodies

Documents & Links for Anti DHCR7 pAb (ATL-HPA044280)
Datasheet Anti DHCR7 pAb (ATL-HPA044280) Datasheet (External Link)
Vendor Page Anti DHCR7 pAb (ATL-HPA044280)