Anti DGUOK pAb (ATL-HPA057246)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057246-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DGUOK
Alternative Gene Name: dGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014554: 66%, ENSRNOG00000011617: 64%
Entrez Gene ID: 1716
Uniprot ID: Q16854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN |
Gene Sequence | EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN |
Gene ID - Mouse | ENSMUSG00000014554 |
Gene ID - Rat | ENSRNOG00000011617 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DGUOK pAb (ATL-HPA057246) | |
Datasheet | Anti DGUOK pAb (ATL-HPA057246) Datasheet (External Link) |
Vendor Page | Anti DGUOK pAb (ATL-HPA057246) at Atlas Antibodies |
Documents & Links for Anti DGUOK pAb (ATL-HPA057246) | |
Datasheet | Anti DGUOK pAb (ATL-HPA057246) Datasheet (External Link) |
Vendor Page | Anti DGUOK pAb (ATL-HPA057246) |