Anti DGUOK pAb (ATL-HPA057246)

Atlas Antibodies

Catalog No.:
ATL-HPA057246-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: deoxyguanosine kinase
Gene Name: DGUOK
Alternative Gene Name: dGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014554: 66%, ENSRNOG00000011617: 64%
Entrez Gene ID: 1716
Uniprot ID: Q16854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN
Gene Sequence EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN
Gene ID - Mouse ENSMUSG00000014554
Gene ID - Rat ENSRNOG00000011617
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DGUOK pAb (ATL-HPA057246)
Datasheet Anti DGUOK pAb (ATL-HPA057246) Datasheet (External Link)
Vendor Page Anti DGUOK pAb (ATL-HPA057246) at Atlas Antibodies

Documents & Links for Anti DGUOK pAb (ATL-HPA057246)
Datasheet Anti DGUOK pAb (ATL-HPA057246) Datasheet (External Link)
Vendor Page Anti DGUOK pAb (ATL-HPA057246)