Anti DGUOK pAb (ATL-HPA057246)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057246-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DGUOK
Alternative Gene Name: dGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014554: 66%, ENSRNOG00000011617: 64%
Entrez Gene ID: 1716
Uniprot ID: Q16854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN |
| Gene Sequence | EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN |
| Gene ID - Mouse | ENSMUSG00000014554 |
| Gene ID - Rat | ENSRNOG00000011617 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DGUOK pAb (ATL-HPA057246) | |
| Datasheet | Anti DGUOK pAb (ATL-HPA057246) Datasheet (External Link) |
| Vendor Page | Anti DGUOK pAb (ATL-HPA057246) at Atlas Antibodies |
| Documents & Links for Anti DGUOK pAb (ATL-HPA057246) | |
| Datasheet | Anti DGUOK pAb (ATL-HPA057246) Datasheet (External Link) |
| Vendor Page | Anti DGUOK pAb (ATL-HPA057246) |