Anti DGUOK pAb (ATL-HPA034766)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034766-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: DGUOK
Alternative Gene Name: dGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014554: 75%, ENSRNOG00000011617: 77%
Entrez Gene ID: 1716
Uniprot ID: Q16854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQI |
Gene Sequence | STFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQI |
Gene ID - Mouse | ENSMUSG00000014554 |
Gene ID - Rat | ENSRNOG00000011617 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DGUOK pAb (ATL-HPA034766) | |
Datasheet | Anti DGUOK pAb (ATL-HPA034766) Datasheet (External Link) |
Vendor Page | Anti DGUOK pAb (ATL-HPA034766) at Atlas Antibodies |
Documents & Links for Anti DGUOK pAb (ATL-HPA034766) | |
Datasheet | Anti DGUOK pAb (ATL-HPA034766) Datasheet (External Link) |
Vendor Page | Anti DGUOK pAb (ATL-HPA034766) |
Citations for Anti DGUOK pAb (ATL-HPA034766) – 1 Found |
Kim, Woosuk; Le, Thuc M; Wei, Liu; Poddar, Soumya; Bazzy, Jimmy; Wang, Xuemeng; Uong, Nhu T; Abt, Evan R; Capri, Joseph R; Austin, Wayne R; Van Valkenburgh, Juno S; Steele, Dalton; Gipson, Raymond M; Slavik, Roger; Cabebe, Anthony E; Taechariyakul, Thotsophon; Yaghoubi, Shahriar S; Lee, Jason T; Sadeghi, Saman; Lavie, Arnon; Faull, Kym F; Witte, Owen N; Donahue, Timothy R; Phelps, Michael E; Herschman, Harvey R; Herrmann, Ken; Czernin, Johannes; Radu, Caius G. [18F]CFA as a clinically translatable probe for PET imaging of deoxycytidine kinase activity. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(15):4027-32. PubMed |