Anti DGKZ pAb (ATL-HPA051336)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051336-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DGKZ
Alternative Gene Name: DAGK5, DAGK6, DGK-ZETA, hDGKzeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040479: 92%, ENSRNOG00000017737: 96%
Entrez Gene ID: 8525
Uniprot ID: Q13574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE |
| Gene Sequence | EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE |
| Gene ID - Mouse | ENSMUSG00000040479 |
| Gene ID - Rat | ENSRNOG00000017737 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DGKZ pAb (ATL-HPA051336) | |
| Datasheet | Anti DGKZ pAb (ATL-HPA051336) Datasheet (External Link) |
| Vendor Page | Anti DGKZ pAb (ATL-HPA051336) at Atlas Antibodies |
| Documents & Links for Anti DGKZ pAb (ATL-HPA051336) | |
| Datasheet | Anti DGKZ pAb (ATL-HPA051336) Datasheet (External Link) |
| Vendor Page | Anti DGKZ pAb (ATL-HPA051336) |