Anti DGKQ pAb (ATL-HPA026797)

Atlas Antibodies

Catalog No.:
ATL-HPA026797-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, theta 110kDa
Gene Name: DGKQ
Alternative Gene Name: DAGK, DAGK4, DAGK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004815: 82%, ENSRNOG00000024112: 84%
Entrez Gene ID: 1609
Uniprot ID: P52824
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
Gene Sequence HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
Gene ID - Mouse ENSMUSG00000004815
Gene ID - Rat ENSRNOG00000024112
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DGKQ pAb (ATL-HPA026797)
Datasheet Anti DGKQ pAb (ATL-HPA026797) Datasheet (External Link)
Vendor Page Anti DGKQ pAb (ATL-HPA026797) at Atlas Antibodies

Documents & Links for Anti DGKQ pAb (ATL-HPA026797)
Datasheet Anti DGKQ pAb (ATL-HPA026797) Datasheet (External Link)
Vendor Page Anti DGKQ pAb (ATL-HPA026797)
Citations for Anti DGKQ pAb (ATL-HPA026797) – 3 Found
Cai, Kai; Sewer, Marion B. cAMP-stimulated transcription of DGKθ requires steroidogenic factor 1 and sterol regulatory element binding protein 1. Journal Of Lipid Research. 2013;54(8):2121-2132.  PubMed
Cai, Kai; Sewer, Marion B. Diacylglycerol kinase θ couples farnesoid X receptor-dependent bile acid signalling to Akt activation and glucose homoeostasis in hepatocytes. The Biochemical Journal. 2013;454(2):267-74.  PubMed
Cai, Kai; Lucki, Natasha C; Sewer, Marion B. Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells. Biochimica Et Biophysica Acta. 2014;1841(4):552-62.  PubMed