Anti DGKH pAb (ATL-HPA039533)

Atlas Antibodies

Catalog No.:
ATL-HPA039533-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, eta
Gene Name: DGKH
Alternative Gene Name: DGKeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034731: 67%, ENSRNOG00000010065: 69%
Entrez Gene ID: 160851
Uniprot ID: Q86XP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLN
Gene Sequence VRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLN
Gene ID - Mouse ENSMUSG00000034731
Gene ID - Rat ENSRNOG00000010065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DGKH pAb (ATL-HPA039533)
Datasheet Anti DGKH pAb (ATL-HPA039533) Datasheet (External Link)
Vendor Page Anti DGKH pAb (ATL-HPA039533) at Atlas Antibodies

Documents & Links for Anti DGKH pAb (ATL-HPA039533)
Datasheet Anti DGKH pAb (ATL-HPA039533) Datasheet (External Link)
Vendor Page Anti DGKH pAb (ATL-HPA039533)