Anti DGKG pAb (ATL-HPA036577)

Atlas Antibodies

Catalog No.:
ATL-HPA036577-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, gamma 90kDa
Gene Name: DGKG
Alternative Gene Name: DAGK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022861: 90%, ENSRNOG00000001796: 86%
Entrez Gene ID: 1608
Uniprot ID: P49619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLA
Gene Sequence MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLA
Gene ID - Mouse ENSMUSG00000022861
Gene ID - Rat ENSRNOG00000001796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DGKG pAb (ATL-HPA036577)
Datasheet Anti DGKG pAb (ATL-HPA036577) Datasheet (External Link)
Vendor Page Anti DGKG pAb (ATL-HPA036577) at Atlas Antibodies

Documents & Links for Anti DGKG pAb (ATL-HPA036577)
Datasheet Anti DGKG pAb (ATL-HPA036577) Datasheet (External Link)
Vendor Page Anti DGKG pAb (ATL-HPA036577)