Anti DGKE pAb (ATL-HPA017167)

Atlas Antibodies

SKU:
ATL-HPA017167-25
  • Immunohistochemical staining of human testis shows distinct positivity in spermatids and spermatozoa.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, epsilon 64kDa
Gene Name: DGKE
Alternative Gene Name: DAGK6, DGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000276: 88%, ENSRNOG00000002338: 86%
Entrez Gene ID: 8526
Uniprot ID: P52429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYL
Gene Sequence RDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYL
Gene ID - Mouse ENSMUSG00000000276
Gene ID - Rat ENSRNOG00000002338
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DGKE pAb (ATL-HPA017167)
Datasheet Anti DGKE pAb (ATL-HPA017167) Datasheet (External Link)
Vendor Page Anti DGKE pAb (ATL-HPA017167) at Atlas Antibodies

Documents & Links for Anti DGKE pAb (ATL-HPA017167)
Datasheet Anti DGKE pAb (ATL-HPA017167) Datasheet (External Link)
Vendor Page Anti DGKE pAb (ATL-HPA017167)