Anti DGKA pAb (ATL-HPA041645)
Atlas Antibodies
- SKU:
- ATL-HPA041645-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DGKA
Alternative Gene Name: DAGK, DAGK1, DGK-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025357: 74%, ENSRNOG00000022943: 73%
Entrez Gene ID: 1606
Uniprot ID: P23743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP |
Gene Sequence | HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP |
Gene ID - Mouse | ENSMUSG00000025357 |
Gene ID - Rat | ENSRNOG00000022943 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DGKA pAb (ATL-HPA041645) | |
Datasheet | Anti DGKA pAb (ATL-HPA041645) Datasheet (External Link) |
Vendor Page | Anti DGKA pAb (ATL-HPA041645) at Atlas Antibodies |
Documents & Links for Anti DGKA pAb (ATL-HPA041645) | |
Datasheet | Anti DGKA pAb (ATL-HPA041645) Datasheet (External Link) |
Vendor Page | Anti DGKA pAb (ATL-HPA041645) |