Anti DGKA pAb (ATL-HPA041645)

Atlas Antibodies

Catalog No.:
ATL-HPA041645-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diacylglycerol kinase, alpha 80kDa
Gene Name: DGKA
Alternative Gene Name: DAGK, DAGK1, DGK-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025357: 74%, ENSRNOG00000022943: 73%
Entrez Gene ID: 1606
Uniprot ID: P23743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP
Gene Sequence HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP
Gene ID - Mouse ENSMUSG00000025357
Gene ID - Rat ENSRNOG00000022943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DGKA pAb (ATL-HPA041645)
Datasheet Anti DGKA pAb (ATL-HPA041645) Datasheet (External Link)
Vendor Page Anti DGKA pAb (ATL-HPA041645) at Atlas Antibodies

Documents & Links for Anti DGKA pAb (ATL-HPA041645)
Datasheet Anti DGKA pAb (ATL-HPA041645) Datasheet (External Link)
Vendor Page Anti DGKA pAb (ATL-HPA041645)