Anti DGKA pAb (ATL-HPA041645)

Atlas Antibodies

SKU: ATL-HPA041645-25

• 

Protein Description: diacylglycerol kinase, alpha 80kDa
Gene Name: DGKA
Alternative Gene Name: DAGK, DAGK1, DGK-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025357: 74%, ENSRNOG00000022943: 73%
Entrez Gene ID: 1606
Uniprot ID: P23743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP
• Gene Sequence: HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP
• Gene ID - Mouse: ENSMUSG00000025357
• Gene ID - Rat: ENSRNOG00000022943
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.