Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011326-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: deafness, autosomal dominant 5
Gene Name: DFNA5
Alternative Gene Name: ICERE-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029821: 66%, ENSRNOG00000009970: 67%
Entrez Gene ID: 1687
Uniprot ID: O60443
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV
Gene Sequence VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV
Gene ID - Mouse ENSMUSG00000029821
Gene ID - Rat ENSRNOG00000009970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation)
Datasheet Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation)
Datasheet Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation)
Citations for Anti DFNA5 pAb (ATL-HPA011326 w/enhanced validation) – 1 Found
Hosoya, Makoto; Fujioka, Masato; Ogawa, Kaoru; Okano, Hideyuki. Distinct Expression Patterns Of Causative Genes Responsible For Hereditary Progressive Hearing Loss In Non-Human Primate Cochlea. Scientific Reports. 2016;6( 26915689):22250.  PubMed