Anti DFFB pAb (ATL-HPA052904)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052904-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DFFB
Alternative Gene Name: CAD, CPAN, DFF-40, DFF40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029027: 84%, ENSRNOG00000025030: 81%
Entrez Gene ID: 1677
Uniprot ID: O76075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN |
Gene Sequence | EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN |
Gene ID - Mouse | ENSMUSG00000029027 |
Gene ID - Rat | ENSRNOG00000025030 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DFFB pAb (ATL-HPA052904) | |
Datasheet | Anti DFFB pAb (ATL-HPA052904) Datasheet (External Link) |
Vendor Page | Anti DFFB pAb (ATL-HPA052904) at Atlas Antibodies |
Documents & Links for Anti DFFB pAb (ATL-HPA052904) | |
Datasheet | Anti DFFB pAb (ATL-HPA052904) Datasheet (External Link) |
Vendor Page | Anti DFFB pAb (ATL-HPA052904) |