Anti DFFA pAb (ATL-HPA025230 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA025230-25

• 
• 

Protein Description: DNA fragmentation factor, 45kDa, alpha polypeptide
Gene Name: DFFA
Alternative Gene Name: DFF-45, DFF1, DFF45, ICAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028974: 82%, ENSRNOG00000013603: 85%
Entrez Gene ID: 1676
Uniprot ID: O00273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCS
• Gene Sequence: TKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCS
• Gene ID - Mouse: ENSMUSG00000028974
• Gene ID - Rat: ENSRNOG00000013603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.