Anti DFFA pAb (ATL-HPA018859)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018859-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DFFA
Alternative Gene Name: DFF-45, DFF1, DFF45, ICAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028974: 76%, ENSRNOG00000013603: 76%
Entrez Gene ID: 1676
Uniprot ID: O00273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP |
| Gene Sequence | MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP |
| Gene ID - Mouse | ENSMUSG00000028974 |
| Gene ID - Rat | ENSRNOG00000013603 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DFFA pAb (ATL-HPA018859) | |
| Datasheet | Anti DFFA pAb (ATL-HPA018859) Datasheet (External Link) |
| Vendor Page | Anti DFFA pAb (ATL-HPA018859) at Atlas Antibodies |
| Documents & Links for Anti DFFA pAb (ATL-HPA018859) | |
| Datasheet | Anti DFFA pAb (ATL-HPA018859) Datasheet (External Link) |
| Vendor Page | Anti DFFA pAb (ATL-HPA018859) |