Anti DEXI pAb (ATL-HPA041511 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041511-25

• 
• 
• 

Protein Description: Dexi homolog (mouse)
Gene Name: DEXI
Alternative Gene Name: MYLE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038055: 96%, ENSRNOG00000002635: 96%
Entrez Gene ID: 28955
Uniprot ID: O95424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
• Gene Sequence: IVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
• Gene ID - Mouse: ENSMUSG00000038055
• Gene ID - Rat: ENSRNOG00000002635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.