Anti DESI2 pAb (ATL-HPA049950)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049950-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DESI2
Alternative Gene Name: C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111522: 100%, ENSRNOG00000004524: 99%
Entrez Gene ID: 51029
Uniprot ID: Q9BSY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY |
| Gene Sequence | VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY |
| Gene ID - Mouse | ENSMUSG00000111522 |
| Gene ID - Rat | ENSRNOG00000004524 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DESI2 pAb (ATL-HPA049950) | |
| Datasheet | Anti DESI2 pAb (ATL-HPA049950) Datasheet (External Link) |
| Vendor Page | Anti DESI2 pAb (ATL-HPA049950) at Atlas Antibodies |
| Documents & Links for Anti DESI2 pAb (ATL-HPA049950) | |
| Datasheet | Anti DESI2 pAb (ATL-HPA049950) Datasheet (External Link) |
| Vendor Page | Anti DESI2 pAb (ATL-HPA049950) |