Anti DESI2 pAb (ATL-HPA049950)

Atlas Antibodies

Catalog No.:
ATL-HPA049950-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: desumoylating isopeptidase 2
Gene Name: DESI2
Alternative Gene Name: C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111522: 100%, ENSRNOG00000004524: 99%
Entrez Gene ID: 51029
Uniprot ID: Q9BSY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
Gene Sequence VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
Gene ID - Mouse ENSMUSG00000111522
Gene ID - Rat ENSRNOG00000004524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DESI2 pAb (ATL-HPA049950)
Datasheet Anti DESI2 pAb (ATL-HPA049950) Datasheet (External Link)
Vendor Page Anti DESI2 pAb (ATL-HPA049950) at Atlas Antibodies

Documents & Links for Anti DESI2 pAb (ATL-HPA049950)
Datasheet Anti DESI2 pAb (ATL-HPA049950) Datasheet (External Link)
Vendor Page Anti DESI2 pAb (ATL-HPA049950)