Anti DESI2 pAb (ATL-HPA049950)

Atlas Antibodies

Catalog No.: ATL-HPA049950-25

Protein Description: desumoylating isopeptidase 2
Gene Name: DESI2
Alternative Gene Name: C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111522: 100%, ENSRNOG00000004524: 99%
Entrez Gene ID: 51029
Uniprot ID: Q9BSY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
• Gene Sequence: VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
• Gene ID - Mouse: ENSMUSG00000111522
• Gene ID - Rat: ENSRNOG00000004524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.