Anti DESI1 pAb (ATL-HPA053415)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053415-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DESI1
Alternative Gene Name: D15Wsu75e, FAM152B, PPPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022472: 95%, ENSRNOG00000005577: 95%
Entrez Gene ID: 27351
Uniprot ID: Q6ICB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE |
| Gene Sequence | IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE |
| Gene ID - Mouse | ENSMUSG00000022472 |
| Gene ID - Rat | ENSRNOG00000005577 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DESI1 pAb (ATL-HPA053415) | |
| Datasheet | Anti DESI1 pAb (ATL-HPA053415) Datasheet (External Link) |
| Vendor Page | Anti DESI1 pAb (ATL-HPA053415) at Atlas Antibodies |
| Documents & Links for Anti DESI1 pAb (ATL-HPA053415) | |
| Datasheet | Anti DESI1 pAb (ATL-HPA053415) Datasheet (External Link) |
| Vendor Page | Anti DESI1 pAb (ATL-HPA053415) |