Anti DESI1 pAb (ATL-HPA053415)

Atlas Antibodies

Catalog No.:
ATL-HPA053415-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: desumoylating isopeptidase 1
Gene Name: DESI1
Alternative Gene Name: D15Wsu75e, FAM152B, PPPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022472: 95%, ENSRNOG00000005577: 95%
Entrez Gene ID: 27351
Uniprot ID: Q6ICB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE
Gene Sequence IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE
Gene ID - Mouse ENSMUSG00000022472
Gene ID - Rat ENSRNOG00000005577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DESI1 pAb (ATL-HPA053415)
Datasheet Anti DESI1 pAb (ATL-HPA053415) Datasheet (External Link)
Vendor Page Anti DESI1 pAb (ATL-HPA053415) at Atlas Antibodies

Documents & Links for Anti DESI1 pAb (ATL-HPA053415)
Datasheet Anti DESI1 pAb (ATL-HPA053415) Datasheet (External Link)
Vendor Page Anti DESI1 pAb (ATL-HPA053415)