Anti DES pAb (ATL-HPA018803 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018803-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: desmin
Gene Name: DES
Alternative Gene Name: CMD1I, CSM1, CSM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026208: 98%, ENSRNOG00000019810: 98%
Entrez Gene ID: 1674
Uniprot ID: P17661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Gene Sequence KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Gene ID - Mouse ENSMUSG00000026208
Gene ID - Rat ENSRNOG00000019810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DES pAb (ATL-HPA018803 w/enhanced validation)
Datasheet Anti DES pAb (ATL-HPA018803 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DES pAb (ATL-HPA018803 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DES pAb (ATL-HPA018803 w/enhanced validation)
Datasheet Anti DES pAb (ATL-HPA018803 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DES pAb (ATL-HPA018803 w/enhanced validation)
Citations for Anti DES pAb (ATL-HPA018803 w/enhanced validation) – 2 Found
Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.  PubMed
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.  PubMed