Anti DERL1 pAb (ATL-HPA016562)

Atlas Antibodies

SKU:
ATL-HPA016562-25
  • Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: derlin 1
Gene Name: DERL1
Alternative Gene Name: DER-1, DER1, derlin-1, FLJ13784, MGC3067, PRO2577
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022365: 100%, ENSRNOG00000005551: 100%
Entrez Gene ID: 79139
Uniprot ID: Q9BUN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Gene Sequence LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Gene ID - Mouse ENSMUSG00000022365
Gene ID - Rat ENSRNOG00000005551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DERL1 pAb (ATL-HPA016562)
Datasheet Anti DERL1 pAb (ATL-HPA016562) Datasheet (External Link)
Vendor Page Anti DERL1 pAb (ATL-HPA016562) at Atlas Antibodies

Documents & Links for Anti DERL1 pAb (ATL-HPA016562)
Datasheet Anti DERL1 pAb (ATL-HPA016562) Datasheet (External Link)
Vendor Page Anti DERL1 pAb (ATL-HPA016562)



Citations for Anti DERL1 pAb (ATL-HPA016562) – 1 Found
Jhan, Jhen-Hao; Hsu, Wei-Chi; Lee, Yi-Chen; Li, Wei-Ming; Huang, A-Mei; Lin, Hui-Hui; Wang, Chien-Sheng; Wu, Yi-Ru; Li, Ching-Chia; Wu, Wen-Jeng; Ke, Hung-Lung. MicroRNA-375-3p Suppresses Upper Tract Urothelial Carcinoma Cell Migration and Invasion via Targeting Derlin-1. Cancers. 2022;14(4)  PubMed