Anti DERA pAb (ATL-HPA055897)

Atlas Antibodies

SKU:
ATL-HPA055897-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: deoxyribose-phosphate aldolase (putative)
Gene Name: DERA
Alternative Gene Name: CGI-26, DEOC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030225: 92%, ENSRNOG00000007570: 91%
Entrez Gene ID: 51071
Uniprot ID: Q9Y315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS
Gene Sequence ISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS
Gene ID - Mouse ENSMUSG00000030225
Gene ID - Rat ENSRNOG00000007570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DERA pAb (ATL-HPA055897)
Datasheet Anti DERA pAb (ATL-HPA055897) Datasheet (External Link)
Vendor Page Anti DERA pAb (ATL-HPA055897) at Atlas Antibodies

Documents & Links for Anti DERA pAb (ATL-HPA055897)
Datasheet Anti DERA pAb (ATL-HPA055897) Datasheet (External Link)
Vendor Page Anti DERA pAb (ATL-HPA055897)