Anti DEPTOR pAb (ATL-HPA024011 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024011-25
  • Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, mitochondria & cell junctions.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DEPTOR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402946).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEP domain containing MTOR-interacting protein
Gene Name: DEPTOR
Alternative Gene Name: DEP.6, DEPDC6, FLJ12428
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022419: 98%, ENSRNOG00000004328: 100%
Entrez Gene ID: 64798
Uniprot ID: Q8TB45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSV
Gene Sequence DSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSV
Gene ID - Mouse ENSMUSG00000022419
Gene ID - Rat ENSRNOG00000004328
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DEPTOR pAb (ATL-HPA024011 w/enhanced validation)
Datasheet Anti DEPTOR pAb (ATL-HPA024011 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DEPTOR pAb (ATL-HPA024011 w/enhanced validation)