Anti DEPTOR pAb (ATL-HPA023945)

Atlas Antibodies

Catalog No.: ATL-HPA023945-25

Protein Description: DEP domain containing MTOR-interacting protein
Gene Name: DEPTOR
Alternative Gene Name: DEP.6, DEPDC6, FLJ12428
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022419: 97%, ENSRNOG00000004328: 97%
Entrez Gene ID: 64798
Uniprot ID: Q8TB45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKH
• Gene Sequence: LYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKH
• Gene ID - Mouse: ENSMUSG00000022419
• Gene ID - Rat: ENSRNOG00000004328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.