Anti DEPDC7 pAb (ATL-HPA015800 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015800-25

• 
• 

Protein Description: DEP domain containing 7
Gene Name: DEPDC7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027173: 80%, ENSRNOG00000012262: 82%
Entrez Gene ID: 91614
Uniprot ID: Q96QD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSS
• Gene Sequence: TTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSS
• Gene ID - Mouse: ENSMUSG00000027173
• Gene ID - Rat: ENSRNOG00000012262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DEPDC7 pAb (ATL-HPA015800 w/enhanced validation) – 1 Found

Liao, Zhijun; Wang, Xinrui; Wang, Xiaojiang; Li, Lisheng; Lin, Dexin. DEPDC7 inhibits cell proliferation, migration and invasion in hepatoma cells. Oncology Letters. 2017;14(6):7332-7338.