Anti DEPDC5 pAb (ATL-HPA055619)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055619-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DEPDC5
Alternative Gene Name: DEP.5, KIAA0645
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037426: 92%, ENSRNOG00000018144: 91%
Entrez Gene ID: 9681
Uniprot ID: O75140
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS |
Gene Sequence | YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS |
Gene ID - Mouse | ENSMUSG00000037426 |
Gene ID - Rat | ENSRNOG00000018144 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619) | |
Datasheet | Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link) |
Vendor Page | Anti DEPDC5 pAb (ATL-HPA055619) at Atlas Antibodies |
Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619) | |
Datasheet | Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link) |
Vendor Page | Anti DEPDC5 pAb (ATL-HPA055619) |
Citations for Anti DEPDC5 pAb (ATL-HPA055619) – 3 Found |
Mizuno, Yuki; Shimada, Shu; Akiyama, Yoshimitsu; Watanabe, Shuichi; Aida, Tomomi; Ogawa, Kosuke; Ono, Hiroaki; Mitsunori, Yusuke; Ban, Daisuke; Kudo, Atsushi; Arii, Shigeki; Yamaoka, Shoji; Tanabe, Minoru; Tanaka, Shinji. DEPDC5 deficiency contributes to resistance to leucine starvation via p62 accumulation in hepatocellular carcinoma. Scientific Reports. 2018;8(1):106. PubMed |
Yuskaitis, Christopher J; Modasia, Jinita B; Schrötter, Sandra; Rossitto, Leigh-Ana; Groff, Karenna J; Morici, Christopher; Mithal, Divakar S; Chakrabarty, Ram P; Chandel, Navdeep S; Manning, Brendan D; Sahin, Mustafa. DEPDC5-dependent mTORC1 signaling mechanisms are critical for the anti-seizure effects of acute fasting. Cell Reports. 2022;40(9):111278. PubMed |
Wang, Ya-Chin; Tsai, Ming-Chao; Chen, Yaw-Sen; Hsieh, Pei-Min; Hung, Chao-Ming; Lin, Hung-Yu; Hsu, Yao-Chun; Yeh, Jen-Hao; Hsiao, Pojen; Su, Yu-Cheih; Ma, Ching-Hou; Lee, Chih-Yuan; Lin, Chih-Che; Shu, Chih-Wen; Li, Yu-Chan; Tsai, Mei-Hsing; Lin, James Yu; Peng, Wei-Hao; Yu, Ming-Lung; Lin, Chih-Wen. NPRL2 down-regulation facilitates the growth of hepatocellular carcinoma via the mTOR pathway and autophagy suppression. Hepatology Communications. 2022;6(12):3563-3577. PubMed |