Anti DEPDC5 pAb (ATL-HPA055619)

Atlas Antibodies

Catalog No.:
ATL-HPA055619-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DEP domain containing 5
Gene Name: DEPDC5
Alternative Gene Name: DEP.5, KIAA0645
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037426: 92%, ENSRNOG00000018144: 91%
Entrez Gene ID: 9681
Uniprot ID: O75140
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS
Gene Sequence YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS
Gene ID - Mouse ENSMUSG00000037426
Gene ID - Rat ENSRNOG00000018144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619)
Datasheet Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link)
Vendor Page Anti DEPDC5 pAb (ATL-HPA055619) at Atlas Antibodies

Documents & Links for Anti DEPDC5 pAb (ATL-HPA055619)
Datasheet Anti DEPDC5 pAb (ATL-HPA055619) Datasheet (External Link)
Vendor Page Anti DEPDC5 pAb (ATL-HPA055619)
Citations for Anti DEPDC5 pAb (ATL-HPA055619) – 3 Found
Mizuno, Yuki; Shimada, Shu; Akiyama, Yoshimitsu; Watanabe, Shuichi; Aida, Tomomi; Ogawa, Kosuke; Ono, Hiroaki; Mitsunori, Yusuke; Ban, Daisuke; Kudo, Atsushi; Arii, Shigeki; Yamaoka, Shoji; Tanabe, Minoru; Tanaka, Shinji. DEPDC5 deficiency contributes to resistance to leucine starvation via p62 accumulation in hepatocellular carcinoma. Scientific Reports. 2018;8(1):106.  PubMed
Yuskaitis, Christopher J; Modasia, Jinita B; Schrötter, Sandra; Rossitto, Leigh-Ana; Groff, Karenna J; Morici, Christopher; Mithal, Divakar S; Chakrabarty, Ram P; Chandel, Navdeep S; Manning, Brendan D; Sahin, Mustafa. DEPDC5-dependent mTORC1 signaling mechanisms are critical for the anti-seizure effects of acute fasting. Cell Reports. 2022;40(9):111278.  PubMed
Wang, Ya-Chin; Tsai, Ming-Chao; Chen, Yaw-Sen; Hsieh, Pei-Min; Hung, Chao-Ming; Lin, Hung-Yu; Hsu, Yao-Chun; Yeh, Jen-Hao; Hsiao, Pojen; Su, Yu-Cheih; Ma, Ching-Hou; Lee, Chih-Yuan; Lin, Chih-Che; Shu, Chih-Wen; Li, Yu-Chan; Tsai, Mei-Hsing; Lin, James Yu; Peng, Wei-Hao; Yu, Ming-Lung; Lin, Chih-Wen. NPRL2 down-regulation facilitates the growth of hepatocellular carcinoma via the mTOR pathway and autophagy suppression. Hepatology Communications. 2022;6(12):3563-3577.  PubMed