Anti DEPDC4 pAb (ATL-HPA039323)

Atlas Antibodies

Catalog No.: ATL-HPA039323-25

Protein Description: DEP domain containing 4
Gene Name: DEPDC4
Alternative Gene Name: DEP.4, FLJ33505
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027173: 29%, ENSRNOG00000012262: 33%
Entrez Gene ID: 120863
Uniprot ID: Q8N2C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRTGVHLCQVLMNHKVFEPVGMKKLFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEFNETLRPGYEMISNPLAQEIG
• Gene Sequence: RRTGVHLCQVLMNHKVFEPVGMKKLFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEFNETLRPGYEMISNPLAQEIG
• Gene ID - Mouse: ENSMUSG00000027173
• Gene ID - Rat: ENSRNOG00000012262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.